PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc03218.1.g00010.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 107aa    MW: 12109.2 Da    PI: 11.8367
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc03218.1.g00010.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.51.3e-2655105151
                                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                                   k+ien + rqvtfskRr+g++ KA+EL vLCda+v+v++fsstg+ly+yss
  Zpz_sc03218.1.g00010.1.am.mk  55 KKIENITSRQVTFSKRRTGLFNKAKELAVLCDAQVSVLVFSSTGRLYDYSS 105
                                   68***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.41347107IPR002100Transcription factor, MADS-box
SMARTSM004326.0E-3547106IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.89E-2547106IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-254969IPR002100Transcription factor, MADS-box
PfamPF003192.9E-2456103IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-256984IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-2584105IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 107 aa     Download sequence    Send to blast
MRMAKLKLVP SFQRGKSTST REFPNLDQPP ASRFVRKQIK SFATGAMVRG KTVMKKIENI  60
TSRQVTFSKR RTGLFNKAKE LAVLCDAQVS VLVFSSTGRL YDYSSTR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641671.13e-29PREDICTED: MADS-box transcription factor 23-like
RefseqXP_015641670.13e-29PREDICTED: MADS-box transcription factor 23-like
RefseqXP_006656060.14e-29PREDICTED: MADS-box transcription factor 23-like
SwissprotQ9LT933e-27AGL71_ARATH; MADS-box protein AGL71
TrEMBLA0A0D3GGC57e-31A0A0D3GGC5_9ORYZ; Uncharacterized protein
STRINGORGLA06G0125600.11e-29(Oryza glaberrima)
STRINGLOC_Os06g23950.12e-29(Oryza sativa Japonica Group)
STRINGBGIOSGA022872-PA2e-29(Oryza sativa Indica Group)
STRINGOB06G22200.12e-29(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51870.22e-28AGAMOUS-like 71